Anti-RPL10A antibody produced in rabbit

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

25 kDa

human, zebrafish, mouse, bovine, goat, guinea pig, canine, horse, rabbit

0.5 mg/mL

western blot: 1 μg/mL

NM_007104

wet ice

−20℃

human ... RPL10A(57396)

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. This gene previously was referred to as NEDD6 (neural precursor cell expressed, developmentally downregulated 6), but it has been renamed RPL10A (ribosomal protein 10a). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Synthetic peptide directed towards the middle region of human RPL10A

Synthetic peptide located within the following region: YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

nwg