Anti-NOLC1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal region of human NOLC1

Anti-NOLC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

NOLC1 encodes for a phosphoprotein, nucleolar and coiled-body phosphoprotein 1 that plays a crucial role in the synthesis of rRNA and the biosynthesis of ribosomes. It also induces tumorigenesis of nasopharyngeal carcinoma (NPC) and works cooperatively with tumor protein 53 for stimulating the MDM2 promoter in NPC cells.

Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

73 kDa

horse, goat, bovine, human, mouse, guinea pig, rat, rabbit, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_004732

Q14978

wet ice

−20℃

human ... NOLC1(9221)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3