Anti-VANGL1 antibody produced in rabbit

HPA025235    Human Protein Atlas characterization data

The gene VANGL1 (vang-like protein 1) is mapped to human chromosome 1p13. The encoded protein is a transmembrane protein and a component of the Wnt-PCP (planar cell polarity) pathway. The VANGL1 protein can interact with planar cell polarity (PCP) core proteins Disheveled, Prickle, and Frizzled, KAI1 (metastasis suppressor Kangai-1) protein and ITF (intestinal trefoil factor) protein.

Vang-like protein 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-VANGL1 antibody produced in rabbit has been used for immunohistochemsitry and immunofluorescence.
Anti-VANGL1 antibody produced in rabbit has been used in western blot and immunostaining.

VANGL1 (vang-like protein 1) is associated with tumor progression in various cancers. In colorectal cancer, it enhances the angiogenesis. In mouse colon cells, overexpression of the VANGL1 gene causes tumorigenicity, invasiveness and adhesion to fibronectin. VANGL1 is upregulated in colon, laryngeal, oral cavity squamous, gastric and hepatocellular cancer tissues. VANGL1 is a planar cell polarity protein. It plays a significant role in embryogenesis and is required for normal embryonic development.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73163.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

RNAi knockdown
recombinant expression
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL

DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY

Q8TAA9

wet ice

−20℃

human ... VANGL1(81839)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1