Anti-UBTF antibody produced in rabbit

HPA006385    Human Protein Atlas characterization data

UBTF (upstream binding transcription factor) is composed of six HMG box domains, which are lined up consecutively. It also contains a dimerization and a transactivation domain. It has two isoforms- UBF1 and UBF2. It is also called NOR (nucleolus organizer region)-90, and is a member of the NOR family, which is a family of ribosomal genes. It is highly expressed in human fetus. This gene is localized to human chromosome 17q21.3.

Nucleolar transcription factor 1 recombinant protein epitope signature tag (PrEST)

Anti-UBTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

UBTF (upstream binding transcription factor) or NOR-90 is a transcriptionally competent NOR as it is active during interphase. It serves as a scaffold to conform chromatin in a transcriptionally favorable condition. It is involved in the transcription of rDNA (ribosomal DNA), when it interacts with Pol I (RNA polymerase 7) enzyme. Along with SL1 (selectivity factor 1) complex, it binds to the enhancer region of rDNA. It acts as a negative regulator of Herpes simplex virus 1 (HSV-1) replication, where it suppresses the expression of viral DNA. It plays a role in tissue development and leukemia development.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70888.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

RNAi knockdown
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK

P17480

wet ice

−20℃

human ... UBTF(7343)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)