Anti-TWSG1 antibody produced in rabbit

HPA014898    Human Protein Atlas characterization data

TWSG1 (twisted gastrulation BMP signaling modulator 1) is a secreted protein, which is highly conserved, and has a hydrophobic leader peptide, and 24 cysteine residues common in humans, mice, zebrafish, and Xenopus. This gene is localized to human chromosome 18p11.3, and is expressed during the whole human developmental process.

Twisted gastrulation protein homolog 1 precursor recombinant protein epitope signature tag (PrEST)

Anti-TWSG1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

TWSG1 (twisted gastrulation BMP signaling modulator 1) is a regulator of BMP (bone morphogenetic protein) signaling, which in turn regulates multiple developmental processes. BMP2 and BMP4 suppress thymocyte differentiation, in thymus, and this effect is repealed by TWSG1. Thus, this protein, produced by thymocytes and thymus epithelium, promotes thymocyte differentiation. It also negatively regulates the proliferation of T-cells and cytokine production. This gene, in turn is suppressed by Tob (transducer of ERBB2). Balance and interaction between TWSG1 and BMP endothelial cell precursor derived regulator (BMPER), is essential for vascular homeostasis and angiogenesis. This protein along with Chordin-like 1, is essential for controlling BMP7 signaling, which limits excessive renal tissue injury.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72799.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

DECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVK

Q9GZX9

wet ice

−20℃

human ... TWSG1(57045)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)