Anti-TAZ antibody produced in rabbit

MFCD03792065

HPA039557    Human Protein Atlas characterization data

Tafazzin (TAZ) is encoded by the WW domain containing transcription regulator 1 (WWTR1) gene mapped to human chromosome Xq28. The encoded protein contains 400 amino acids. It is characterized by a conserved WW domain, implicated in binding PPXY motif, a coiled-coil region associated with protein-protein interaction and a C-terminal motif involved in binding the PDZ domain.

tafazzin recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Anti-TAZ antibody produced in rabbit has been used in immunohistochemistry and immunoprecipitation.

Tafazzin (TAZ) plays a vital role in the various cellular process including cell proliferation, differentiation, apoptosis, migration, invasion, epithelial-mesenchymal transition (EMT) and stemness in multiple human cancers. TAZ associates with other transcription factors such as RUNX2 (runt-related transcription factor 2), PPAR (peroxisome proliferator-activated receptor), PAX3 and 8 (paired box gene 3 and 8) and TTF1 (thyroid transcription factor 1) and plays an essential role in osteoblastic, myogenic and adipogenic differentiation.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77964.

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunohistochemistry: 1:20- 1:50

WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP

Q16635

wet ice

−20℃

human ... TAZ(6901)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1