Anti-TARDBP (ab1) antibody produced in rabbit

NA.41

TAR DNA binding protein (TARDBP) is a DNA and RNA binding transcription repressor and regulator of pre-mRNA splicing and translation. TARDBP binds to the regulatory element TAR found in the transcription initiation site of the HIV-1 gene Tat; consequently TARDBP is an active repressor of chromosomally integrated HIV-1 tat. TARDBP also regulates alternative splicing of CFTR and apo-II genes. A defective form of TARDBP is associated with amyotrophic lateral sclerosis (ALS).

Anti-TARDBP (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, chicken, and canine TAR DNA binding protein(s).

Synthetic peptide directed towards the N terminal region of human TARDBP

Anti-TARDBP (AB1) polyclonal antibody is used to tag TAR DNA binding protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of TAR DNA binding protein in the repression of gene expression and regulation of pre-mRNA splicing and translation.

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.

Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

45 kDa

dog, guinea pig, mouse, bovine, horse, human, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_031401

Q13148

wet ice

−20℃

human ... TARDBP(23435)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1