抗-SMARCB1 兔抗

HPA018248    Human Protein Atlas characterization data

The gene SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) is mapped to human chromosome 22q11.23. The protein is localized in the nucleus.

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Anti-SMARCB1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) is member of chromatin-remodelling SWI/SNF (SWItch/Sucrose Non-Fermentable) multiprotein complex. SMARCB1 directly interacts with other components of the complex including BRG1-associated factor 170 (BAF170) and BAF155. PIH1 domain-containing protein-1 (PIH1) interacts with histone H4 and recruits SWI/SNF complex via SMARCB1, thereby regulating chromatin remodeling at the core promoter of rRNA genes. Mutations in SMARCB1 are associated with formation of malignant rhabdoid tumors. SMARCB1 controls G1-S transition of the cell cycle. Overexpression of SMARCB1 leads to cell cycle arrest in malignant rhabdoid tumor cells. SMARCB1 germline mutations are associated with familial schwannomatosis. Similarly, SMARCB1 mutations are observed in humans with coffin-siris syndrome. SMARCB1 interacts and stimulates HIV (Human immunodeficiency virus)-1 integrase activity, catalyzing the integration of retroviral cDNA into host chromosome.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74552.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

rat, mouse, human

antibody small pack of 25 μL

independent
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE

Q12824

wet ice

−20℃

human ... SMARCB1(6598)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)