Anti-SMARCB1 (AB2) antibody produced in rabbit

NA.41

SMARCB1 is a tumor suppressor gene that is inactivated in epithelial cancers. Furthermore, studies have reported that SMARCB1 expression is absent in malignant rhabdoid cancers of kidney, CNS and soft tissues.
Rabbit Anti-SMARCB1 antibody recognizes bovine, chicken, canine, human, mouse, rat, and zebrafish SMARCB1.

Synthetic peptide directed towards the middle region of human SMARCB1

Rabbit Anti-SMARCB1 can be used for western blot applications at a concentration of 0.5 μg/ml.

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

Synthetic peptide located within the following region: ILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

43 kDa

bovine, dog, rabbit, rat, mouse, human, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

NP_003064

Q12824-2

wet ice

−20℃

human ... SMARCB1(6598)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3