Anti-RNF135 antibody produced in rabbit

HPA021576    Human Protein Atlas characterization data

Ring finger protein 135 (RNF135) gene is mapped to chromosome 17q11.2 within the NF1 (neurofibromin 1) gene locus. It codes for a ring finger domain-containing E3 ubiquitin ligase expressed in the cortex and cerebellum. RNF 135, also known as riplet, contains RING domain in its N-terminal and C-terminal SPRY (SPla and the Ryanodine) and PRY motifs.

RING finger protein 135 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ring finger protein 135 (RNF135) ubiquitinates RIG-I (retinoic acid-inducible gene 1) and activates its signal transduction pathway that stimulates human innate immunity against RNA virus infection. Mutation in RNF135 gene, within the NF1 (neurofibromin 1) microdeletion region, leads to overgrowth, learning disability, malformed appearance and other phenotypic abnormalities. This protein acts as a bio-marker and therapy target of glioblastoma.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75892.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL

LSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLK

Q8IUD6

wet ice

−20℃

human ... RNF135(84282)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1