Anti-RHOF antibody produced in rabbit

NA.41

Ras homolog family member F, filopodia associated (RHOF), also referred to as RIF, is encoded by the gene mapped to human chromosome 12q24.31. RHOF belongs to the Rho‐GTPase family. The encoded protein is primarily expressed in spleen, peripheral blood lymphocytes, isolated lymphoid tissue and bone marrow. In addition, it is also expressed in the gastrointestinal tract, including stomach and colorectal tissue.

Synthetic peptide directed towards the middle region of human RHOF

Members of Rho family play a vital role in intracellular signaling pathways implicated in regulation of gene transcription, cell cycle entry and cell survival. Ras homolog family member F, filopodia associated (RHOF) is implicated in neuronal function. The encoded protein stimulates neurite retraction in cells by regulating FARP1(FERM, ARH/RhoGEF and pleckstrin domain protein 1). Overexpression of the gene has been observed in transformed follicular lymphomas (FTL).

Synthetic peptide located within the following region: DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

23 kDa

sheep, rat, mouse, horse, bovine, rabbit, human, guinea pig, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_019034

Q9HBH0

wet ice

−20℃

human ... RHOF(54509)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3