Anti-RHOBTB1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human RHOBTB1

RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate transcriptional splice variants have been characterized.

Synthetic peptide located within the following region: DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

77 kDa

goat, dog, human, horse, rabbit, guinea pig, bovine, mouse, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_055651

O94844

wet ice

−20℃

human ... RHOBTB1(9886)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3