Anti-RBP2 antibody produced in rabbit

HPA035866    Human Protein Atlas characterization data

The gene RBP2 (retinol-binding protein 2) is mapped to human chromosome 3q23. It is mainly expressed in the small intestine and is a cytosolic protein. . It belongs to the CRBP (cellular retinoic-acid-binding protein) intracellular lipid-binding protein family.

retinol binding protein 2, cellular recombinant protein epitope signature tag (PrEST)

Anti-RBP2 antibody produced in rabbit has been used in Western Blotting and immunocytochemistry.

RBP2 (retinol-binding protein 2) is responsible for vitamin A absorption/uptake. It works as a cellular retinoid chaperone. RBP2 associates with retinol and retinal, thereby assisting in retinoid homeostasis.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79303.

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC

P50120

wet ice

−20℃

human ... RBP2(5948)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1