Anti-RBAK antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human RBAK

RBAK encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif.This gene encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif.

Synthetic peptide located within the following region: HYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

83 kDa

horse, bovine, human, guinea pig, rat, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_066986

Q9NYW8

wet ice

−20℃

human ... RBAK(57786)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3