Anti-NECTIN2 antibody produced in rabbit

HPA012759    Human Protein Atlas characterization data

Poliovirus receptor-related protein 2 (PVRL2) is a member of the immunoglobulin (Ig) superfamily. It contains three homologous Ig domains, an N-terminal variable-like (V) domain and two constant-like (C2) domains. PVRL2 is localized to the cadherin-based adherens junctions and cell junctions. The gene encoding this protein is present on chromosome 19q13.2-q13.4.

nectin cell adhesion molecule 2 recombinant protein epitope signature tag (PrEST)

Anti-PVRL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Poliovirus receptor-related protein 2 (PVRL2) plays an important role as a glycoprotein D (gD) receptor for the entry of variant forms of herpes simplex virus 1 (HSV-1), herpes simplex virus 2 (HSV-2) and porcine pseudorabies virus (PRV). PVRL2 also has a role in cell-to-cell adhesion. It has been shown that knockout of the PVRL2 gene in mice results in male sterility because of the defects in spermatogenesis. PVRL2 is a ligand for DNAX Accessory Molecule-1 (DNAM-1) activating receptor. It′s binding and interaction enhances the natural killer (NK)-mediated lysis of tumor cells.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71916.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunohistochemistry: 1:200- 1:500

VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR

wet ice

−20℃

human ... PVRL2(5819)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)