Anti-POMT2 (AB1) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human POMT2

Anti-POMT2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

POMT2 gene encodes for protein-O-mannosyltransferase 2 that catalyzes the initial step of O-mannosyl glycan biosynthesis along with POMT1. It also facilitates the transfer of mannosyl residue to hydroxyl group of serine or threonine. Both POMT1 and POMT2 are essential for the enzyme activity, expression of either POMT1 or POMT2 alone is insufficient. Defect in POMT2 gene results in walker-warburg syndrome, which is a congenital muscular dystrophy with abnormal neuronal migration.

Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

38 kDa

bovine, rabbit, human, horse, mouse, rat, guinea pig, dog

0.5 mg - 1 mg/mL

western blot: suitable

NP_037514

Q9UKY4

wet ice

−20℃

human ... POMT2(29954)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3