抗-PID1 兔抗

HPA036103    Human Protein Atlas characterization data

NYGGF4 (phosphotyrosine interaction domain containing 1, PID1) is linked to obesity-associated insulin resistance (IR) wherein overexpression of NYGGF4 in cells such as 3T3-L1 adipocytes decreases mitochondrial mass, mitochondrial DNA, and intracellular ATP synthesis. NYGGF4 effects on IR may be reversed by metformin through activating IRS-1/PI3K/Akt and AMPK-PGC1-α pathways.
Rabbit polyclonal anti-PID1 antibody reacts with human phosphotyrosine interaction domain containing 1(NYGGF4).

phosphotyrosine interaction domain containing 1 recombinant protein epitope signature tag (PrEST)

Rabbit polyclonal anti-PID1 antibody is used to tag phosphotyrosine interaction domain containing 1 (NYGGF4) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of phosphotyrosine interaction domain containing 1 (NYGGF4) in obesity-associated insulin resistance.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79146.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG

Q7Z2X4

wet ice

−20℃

human ... PID1(55022)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1