Anti-OLIG3 antibody produced in rabbit

MFCD03791924

HPA018303    Human Protein Atlas characterization data

The gene OLIG3 (Oligodendrocyte transcription factor-3) has been mapped to human chromosome 6q23.3. It belongs to a novel subfamily of basic helix-loop-helix transcription factors and consists of three members, OLIG1, OLIG2 and OLIG3. OLIG3 is expressed in the embryonic central nervous system, particularly in the dorsal neural tube from the midbrain/hindbrain boundary to the spinal cord.

Oligodendrocyte transcription factor 3 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Anti-OLIG3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Oligodendrocyte transcription factor-3 (OLIG3) is essential for development of class-A neurons in the dorsal spinal cord and represses the emergence of class-B neurons. Wnt/β-catenin acts upstream of OLIG3 and controls expression of OLIG3, this regulates specification of spinal cord neurons. Single nucleotide polymorphism within OLIG3 reduces methotrexate monotherapy response in patients with inflammatory polyarthritis.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73755.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20-1:50

NSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGR

Q7RTU3

wet ice

−20℃

human ... OLIG3(167826)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)