Anti-NSUN5C antibody produced in rabbit

NA.41

NOP2/Sun domain family, member 5 pseudogene 2 (NSUN5C) is a putative methyltransferase.

Synthetic peptide directed towards the middle region of human NSUN5C

Anti-NSUN5C antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.This gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

34 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_115534

Q63ZY6

wet ice

−20℃

human ... NSUN5C(260294)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3