Anti-MAPKAPK5 antibody produced in rabbit

MFCD04118560

HPA015515    Human Protein Atlas characterization data

MAPKAPK5 (mitogen-activated protein kinase-activated protein kinase 5) is a Ser/Thr kinase, which belongs to a family of MAPK-phosphorylated kinases called MAPKAPK. In humans, eleven such MAPKAPK exist, which are divided into four groups, and MAPKAPK5 belongs to the fourth group, along with MAPKAPK 2 and 3. It was initially recognized as p38 MAKP-activated protein, and is a protein composed of 471 amino acids. It has a ubiquitous expression pattern, and resides primarily in the cytoplasm. This protein shuttles between the cytoplasm and nucleus, and thus, supposedly contains both nuclear localization sequence (NLS) and nuclear export sequence (NES).

MAP kinase-activated protein kinase 5 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

MAPKAPK5 (mitogen-activated protein kinase-activated protein kinase 5) is acted upon by ERK (extracellular signal regulated kinase) 3, ERK4 and mitogen-activated protein kinases p38. It acts as a tumor suppressor gene or as an oncogene, and controls cell locomotion, cell cycle control, embryo development and anxiety. It is activated by the presence of microbial pathogen, to elicit an immune response. It is an interacting partner of DJ-1, which is a mitogen-dependent oncogene product. Induction of DJ-1 leads to the accumulation of Daxx in the nucleus, thereby preventing cell apoptosis under oxidative stress. It is involved in doxorubicin-resistance in hepatocellular carcinoma cells, where it is involved in suppressing doxorubicin-induced apoptosis. Doxorubicin also induces the degradation of this protein. This protein interacts with and phosphorylates heat shock protein 27 (Hsp27), which in turn mediates PKA (protein kinase A)-induced rearrangement of F-actin.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73480.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

rat, mouse, human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH

Q8IW41

wet ice

−20℃

human ... MAPKAPK5(8550)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)