Anti-KEAP1 (AB1) antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

70 kDa

horse, dog, pig, human, mouse, rabbit, bovine, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_036421

Q14145

wet ice

−20℃

human ... KEAP1(9817)

KEAP1 codes for a KELCH-1 like domain-containing protein that interacts with NF-E2-related factor 2. KEPAP1 has been implicated in cell signaling pathways that regulate responses to environmental and oxidative stresses.
Rabbit Anti-KEAP1 antibody recognizes pig, zebrafish, canine, bovine, human, mouse, and rat KEAP1.

Synthetic peptide directed towards the N terminal region of human KEAP1

Rabbit Anti-KEAP1 antibody is suitable for western blot (0.5 μg/ml) applications.

KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

Synthetic peptide located within the following region: SQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 2