Anti-GEM antibody produced in rabbit

NA.41

Gem/Kir, a Rad/Rem/Gem/Kir (RGK) GTPases family member, is a small GTP-binding protein involved in the regulation (inhibition) of high voltage-activated (HVA) Ca²⁺ channels, such as the P/Q-Type Ca²⁺ channels, that modulate neural, endocrine and muscle functions.

Anti-GEM polyclonal antibody reacts with bovine, human, mouse, rat, canine, and chicken Gem/Kir GTPase proteins.

Synthetic peptide directed towards the C terminal region of human GEM

Anti-GEM polyclonal antibody is used to tag Gem/Kir GTPase proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of Gem/Kir as inhibitors of high voltage-activated (HVA) Ca²⁺ channels within neural, endocrine and muscle tissues.

GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Synthetic peptide located within the following region: ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

33 kDa

human, bovine, rabbit, rat, mouse, dog, horse, guinea pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_859053

P55040

wet ice

−20℃

human ... GEM(2669)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3