Anti-GALNT13 antibody produced in rabbit

NA.41

GALNT13 is particularly expressed in fetal brain, adult cerebellum, cerebral cortex and whole brain. GALNT13 transcripts are exclusively present in neuroblastoma cells.

Synthetic peptide directed towards the N terminal region of human GALNT13

Anti-GALNT13 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

GALNT13 (Polypeptide N-acetylgalactosaminyltransferase 13) catalyzes the O-linked glycosylation of mucins by transfer of N-acetylgalactosamine (GalNAc) with an α-linkage to a serine or threonine residue in protein. It may act as a molecular marker for bone marrow dissemination in human neuroblastoma. GALNT13 is linked to sickle cell disease-associated increased tricuspid regurgitation jet velocity.

Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

64 kDa

horse, dog, bovine, rabbit, mouse, human, rat

0.5 mg - 1 mg/mL

western blot: suitable

NP_443149

Q8IUC8

wet ice

−20℃

human ... GALNT13(114805)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3