Anti-GALNT10 antibody produced in rabbit

NA.41

GALNT10 codes for polypeptide N-acetylgalactosaminyltransferase 10 that is involved in the synthesis of mucin-type oligosaccharides. It catalyzes the transfer of GalNAc from UDP-GalNAc to serine or threonine residues in proteins.
Rabbit Anti-GALNT10 antibody recognizes zebrafish, human, mouse, and rat GALNT10.

Synthetic peptide directed towards the N terminal region of human GALNT10

Rabbit Anti-GALNT10 antibody is suitable for western blot applications at a concentration of 1μg/ml.

GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene.

Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

31 kDa

human, rat, mouse, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

NP_938080

Q86SR1

wet ice

−20℃

human ... GALNT10(55568)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3