Anti-GABPA antibody produced in rabbit

NA.41

GA-binding protein (GABP) is a member of Ets family of transcription factors that functions as a heterodimer. The α subunit binds to DNA while the β subunit enables transactivation of the target genes.

Synthetic peptide directed towards the C terminal region of human GABPA

Anti-GABPA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

GABPA subunit has a distinct role cell cycle progression, embryogenesis and synaptic function at neuromuscular junctions. It is reported to regulate the cell migration and cytoskeletal changes in breast epithelial cells.

Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

51 kDa

human, mouse, bovine, horse, rat, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_002031

Q06546

wet ice

−20℃

human ... GABPA(2551)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3