Anti-FOXO1 (AB2) antibody produced in rabbit

NA.41

Forkhead box O1/forkhead in rhabdomyosarcoma (FOXO1, FKH1, FKHR, FOXO1A), a forkhead transcription factor, is a preadipocye and myogenic differentiation factor and embryonic stem cell (ESC) maintenance factor that regulates gluconeogenesis and glycogenolysis by insulin signaling.
Rabbit polyclonal anti-FOXO1 antibody reacts with bovine, pig, canine, human, mouse, rat, zebrafish, and chicken Forkhead box O1/forkhead in rhabdomyosarcoma transcription factors.

Synthetic peptide directed towards the C terminal region of human FOXO1

Rabbit Anti-FOXO1 (AB2) antibody can be used for western blot applications at 1μg/ml.
Rabbit polyclonal anti-FOXO1 antibody is used to tag Forkhead box O1/forkhead in rhabdomyosarcoma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Forkhead box O1/forkhead in rhabdomyosarcoma in cell differentiation, ESC maintenance and processes such as gluconeogenesis and glycogenolysis.

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: HPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

70 kDa

rat, rabbit, horse, human, guinea pig, dog, mouse, bovine

0.5 mg - 1 mg/mL

western blot: suitable

NP_002006

Q12778

wet ice

−20℃

human ... FOXO1(2308)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3