Anti-FAU antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human FAU

Anti-FAU antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

FAU (FBR-MuSV associated ubiquitously expressed gene) gene is the cellular counterpart of the fox sequence present in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). FAU gene is mapped on to chromosome 11 at 11q13 and is ubiquitously expressed. It encodes a fusion protein comprising ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. Fubi belongs to ubiquitin family whereas ribosomal protein S30 is a member of S30E family of ribosomal proteins. S30 is a component of 40S ribosomal subunit and facilitates the antimicrobial activity. FAU gene is a pro-apoptotic regulatory gene that augments basal apoptosis in human T-cell lines and 293T/17 cells.

Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

14 kDa

bovine, rat, mouse, guinea pig, rabbit, human, dog, horse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001988

P62861

wet ice

−20℃

human ... FAU(2197)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3