Anti-EIF3M antibody produced in rabbit

NA.41

EIF3M codes a unit of the eukaryotic translation initiation factor that regulates protein synthesis. Studies have reported that eIF3m expression modulates tumrogenesis genes in human colon cancer.
Rabbit Anti-EIF3M antibody recognizes canine, bovine, zebrafish, human, mouse, rat, and chicken EIF3M.

Synthetic peptide directed towards the N terminal region of human EIF3M

Rabbit Anti-EIF3M antibody is suitable for western blot applications at a concentration of 1μg/ml and for IHC at 4-8μg/ml.

EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].

Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

42 kDa

horse, rat, guinea pig, bovine, dog, rabbit, human, mouse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_006351

Q7L2H7

wet ice

−20℃

human ... EIF3M(10480)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3