Anti-CLCC1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human CLCC1

Anti-CLCC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Chloride channel CLIC-like 1 (CLCC1; Mid-1 related chloride channel, MCLC) belongs to the family of chloride channels present at the plasma membrane and membranes of intracellular compartments. They are involved in the regulation of cell volume and acidification of intracellular compartments. Chloride channels may modulate cell growth and apoptosis. CLCC1 is expressed in membranes of endoplasmic reticulum, Golgi apparatus, and nucleus.

Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

61 kDa

mouse, dog, pig, human, rabbit, bovine, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001041675

Q96S66

wet ice

−20℃

human ... CLCC1(23155)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3