Anti-BMP2K antibody produced in rabbit

NA.41

BMP2 inducible kinase (BMP2K) is a 126 kDa protein. The protein is also recognized as clathrin-coated vesicle-associated protein. BMP2K gene is located on human chromosome 4q21.21.

Synthetic peptide directed towards the middle region of human BMP2K

BMP2 inducible kinase (BMP2K) is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Two transcript variants encoding different isoforms have been found for this gene.
BMP2K contributes to phosphorylation of myelin basic protein. The protein is important in protein-protein interactions. BMP2K is linked to myopia. It is a potential target for treating human immunodeficiency virus (HIV).

Synthetic peptide located within the following region: VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

74 kDa

yeast, guinea pig, mouse, human

0.5 mg - 1 mg/mL

western blot: suitable

Q4W5H2

wet ice

−20℃

human ... BMP2K(55589)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3