Anti-APOBEC3D antibody produced in rabbit

NA.41

Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative) (APOBEC3D) together with other APOBEC3 proteins are potent restriction factors for human immunodeficiency virus type 1 (HIV-1).

Anti-APOBEC3D antibody reacts with human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative) proteins.

Synthetic peptide directed towards the N terminal region of human APOBEC3D

Anti-APOBEC3D antibody is used to tag apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative) proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative) in HIV-1 infection resistance within T-cells.

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.

Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

30 kDa

human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_689639

Q96AK3

wet ice

−20℃

human ... APOBEC3D(140564)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3