Monoclonal Anti-TRIP6 antibody produced in mouse

MFCD04118709

NA.41

This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. (provided by RefSeq)

TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

4B7, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

IgG3κ

NM_003302

Q15654

dry ice

−20℃

human ... TRIP6(7205)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)