Monoclonal Anti-MIF antibody produced in mouse

MFCD00211612

NA.41

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. (provided by RefSeq)
Macrophage migration inhibitory factor (MIF) is a 37.5kDa homotrimer protein. It is expressed in various cells like monocytes, macrophages, vascular smooth muscle cells (SMCs) and cardiomyocytes. This gene is located on human chromosome 21q22.33.(1)

MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Macrophage migration inhibitory factor (MIF) can induce inflammation. Aberrations in MIF result in several inflammatory diseases, such as ulcerative colitis (UC), psoriasis and tuberculosis (TB).(1) It controls the anti-inflammator effects of glucocorticoids. MIF plays pro-inflammatory roles in inflammatory diseases like rheumatoid arthritis, sepsis, acute respiratory distress syndrome and glomerulonephritis.(2)

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2A10-4D3, monoclonal

buffered aqueous solution

human

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

BC000447

P14174

dry ice

−20℃

human ... MIF(4282)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)