Monoclonal Anti-JAM2 antibody produced in mouse

NA.41

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types and may play a role in lymphocyte homing to secondary lymphoid organs. (provided by RefSeq)

JAM2 (AAH17779, 29 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1G4, monoclonal

buffered aqueous solution

human

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

BC017779

P57087

dry ice

−20℃

human ... JAM2(58494)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)