Monoclonal Anti-IDH2, (C-terminal) antibody produced in mouse

NA.41

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. (provided by RefSeq)

IDH2 (NP_002159, 354 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

2G10, monoclonal

buffered aqueous solution

antigen ~36.89 kDa

human

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2bκ

NM_002168

P48735

dry ice

−20℃

human ... IDH2(3418)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1