Monoclonal Anti-GYG1 antibody produced in mouse

NA.41

Glycogenin 1 (GYG1), is one of the glycogen synthetic enzymes. It is present in the skeletal and cardiac muscle. GYG1 codes for muscle glycogenin. This gene is located on human chromosome 3q24.

GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT

Monoclonal Anti-GYG1 antibody has been used in immunohistochemical analysis.

Glycogenin 1 (GYG1) participates in blood glucose homeostasis. It is essential for normal and functional glycogen particles. Mutations in GYG1 is linked with polyglucosan structures.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3B5, monoclonal

buffered aqueous solution

rat, mouse, human

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_004130

P46976

dry ice

−20℃

human ... GYG1(2992)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)