Monoclonal Anti-GSTA2, (N-terminal) antibody produced in mouse

NA.41

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual′s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. (provided by RefSeq)

GSTA2 (AAH02895, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

purified immunoglobulin

primary antibodies

3D4, monoclonal

buffered aqueous solution

antigen ~37.11 kDa

human

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

BC002895

P09210

dry ice

−20℃

human ... GSTA2(2939)

13 - Non Combustible Solids

WGK 1