Monoclonal Anti-GPRC5D antibody produced in mouse

NA.41

G protein-coupled receptor 5D (GPRC5D), a surface receptor consists of seven putative transmembrane segments. It is expressed in the cell membrane. This protein belongs to the retinoic acid inducible gene 1 or retinoic acid inducible GPCR 1 (RAIG1) family. GPRC5D is located on human chromosome 12p13.

GPRC5D (NP_061124, 261 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

G protein-coupled receptor 5D (GPRC5D) considered as an important marker for monitoring the tumor load and also to target multiple myeloma cells. Overexpression of GPRC5D affects the expression of hard keratins and also decrease the metabolic activities of hair bulb cells (HBCs).

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

6D9, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2bκ

NM_018654

Q9NZD1

dry ice

−20℃

human ... GPRC5D(55507)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)