Monoclonal Anti-GMNN antibody produced in mouse

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1A8, monoclonal

buffered aqueous solution

human

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

BC005185

O75496

dry ice

−20℃

human ... GMNN(51053)

Geminin (GMNN) is a nuclear regulator protein encoded by GMNN gene. This gene is located on human chromosome 6p22.3. It is expressed in the the cell cycle during S, G2 and M phases.

GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

Geminin (GMNN) prevents replication of DNA. It participates in cancer pathophysiology and developmental process. This protein also participates in several stages of development like pre-implantation, germ layer formation, cell commitment and specification. It also has roles in the maintenance of genome integrity at mid blastula transition, epithelial to mesenchymal transition during gastrulation, neural development, organogenesis and axis patterning. GMNN controls chromatin remodeling.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)