Monoclonal Anti-FKBP6 antibody produced in mouse

NA.41

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein may have cis-trans prolyl isomerase activity, and binds to clathrin heavy chain and heat shock protein 72. This gene is found to be deleted in Williams syndrome, and the orthologous gene in mouse is essential for fertility and homologous pairing in male meiosis. (provided by RefSeq)

FKBP6 (NP_003593.2, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELA

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

8F10, monoclonal

buffered aqueous solution

antigen 37.62 kDa

human

ELISA: suitable
western blot: 1-5 μg/mL

IgG2a

NM_003602

O75344

dry ice

−20℃

human ... FKBP6(8468)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1