Monoclonal Anti-CCNT2 antibody produced in mouse

NA.41

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. Two alternatively spliced transcript variants, which encode distinct isoforms, have been described. (provided by RefSeq)

CCNT2 (NP_490595, 264 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET

Cyclin T2 (CCNT2) is required as a cofactor and activator. It has roles in different cellular pathways such as transcriptional elongation, differentiation and apoptosis. CCNT2 phosphorylates the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNAP II).

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1H3, monoclonal

buffered aqueous solution

human

capture ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_058241

O60583

dry ice

−20℃

human ... CCNT2(905)

12 - Non Combustible Liquids