Monoclonal Anti-ASB10 antibody produced in mouse

NA.41

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. The SOCS box serves to couple suppressor of cytokine signaling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene. (provided by RefSeq)

ASB10 (NP_001135931, 48 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW

ASB10 (ankyrin repeat and SOCS box containing 10) plays a vital role in the ubiquitination-mediated proteasomal and autophagy-lysosomal degradation pathways. The ANK repeat containing domain is responsible for protein-protein interactions whereas the SOCS (suppressor of cytokine signaling) box motif helps in ubiquitination of the protein by binding to the multisubunit E3 ubiquitin ligase complex. ASB family interacts specifically with Cul5-Rbx2 in cells to form an E3 ubiquitin (Ub) ligase complex.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1F3, monoclonal

buffered aqueous solution

rat, human, mouse

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_001142459

Q8WXI3

dry ice

−20℃

human ... ASB10(136371)

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)